PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000319634
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 484aa    MW: 53365.9 Da    PI: 7.5948
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000319634genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.71.2e-12173218146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g+W +eEde l++ vk+ G+++W++I ++  + Rt+k+c++rw +
    MDP0000319634 173 KGPWKAEEDEVLLKHVKKCGPRDWSSIRSKGLLQRTGKSCRLRWVN 218
                      79*************************8887799**********87 PP

2Myb_DNA-binding40.94.9e-13229268344
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      +++ eE+   +++ +q+G++ W++Ia +++ gRt++++k++w
    MDP0000319634 229 KFSVEEERVVIELQAQFGNK-WARIATYLP-GRTDNDVKNFW 268
                      799*****************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.5E-20167221IPR009057Homeodomain-like
PROSITE profilePS5129420.57168224IPR017930Myb domain
SuperFamilySSF466891.21E-27170268IPR009057Homeodomain-like
SMARTSM007172.6E-10172222IPR001005SANT/Myb domain
CDDcd001678.42E-11175220No hitNo description
PfamPF139211.5E-11176226No hitNo description
Gene3DG3DSA:1.10.10.602.1E-17222274IPR009057Homeodomain-like
PROSITE profilePS5129418.315225276IPR017930Myb domain
SMARTSM007174.4E-12226274IPR001005SANT/Myb domain
PfamPF002492.3E-11229268IPR001005SANT/Myb domain
CDDcd001674.02E-10229268No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 484 aa     Download sequence    Send to blast
METAVAVGPR PTCGGRCHAA QLGWAVMSSR KACAGNSFTM PFKAFAVASL YIGSIATAGV  60
AGIRKAGDLV ELGANLRTGL GISSLVANGE KYKPNGYLLV ICYRRIVDGF VIHHLFLLLF  120
SNIAFTACQG KYGDEGMALX ASLLAGVTFL ASXNFSAVFL VELKSKKEEG IRKGPWKAEE  180
DEVLLKHVKK CGPRDWSSIR SKGLLQRTGK SCRLRWVNKL RPNLKNGCKF SVEEERVVIE  240
LQAQFGNKWA RIATYLPGRT DNDVKNFWSS RQKRLARILQ TSAAAPATPS SKSHKTKXEV  300
SXFXELPTIV EATKFNCXSE GEPSSQAQPC LSXPPYXRNS EIIKMVPLPD IVKPKSLCFE  360
TNPVQHELPI TDKDPWTDSH SVIPFLQNPQ PQTDQIFSSE TQEFLARFDP YFDMLGPLDA  420
LELGNGGEPL VMEPPLFEPV GSCLSCEXEK IDHTMTPDCV FDDFPTDMFD QFDPLPNTSG  480
SGQH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C2e-2817127425126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008375755.10.0PREDICTED: myb-related protein Zm38
TrEMBLM5VT831e-153M5VT83_PRUPE; Uncharacterized protein
STRINGVIT_15s0021g02040.t011e-108(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36933164
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.16e-86MYB family protein